Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 27 of 27 results

(reset)

ACOT12 Rabbit Polyclonal Antibody

TA312609

USD 345.00

4 Weeks

Rabbit polyclonal anti-ACOT12 antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human ACOT12.

1 / 2

2 / 2

Previous Next

ACOT12 Rabbit Polyclonal Antibody

TA340256

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACOT12 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACOT12 antibody: synthetic peptide directed towards the middle region of human ACOT12. Synthetic peptide located within the following region: SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

CF502396

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACOT12 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1B9]

CF502462

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACOT12 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

CF502477

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACOT12 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1D3]

CF502530

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACOT12 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF502686

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACOT12 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

TA502396

USD 379.00

In Stock

ACOT12 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACOT12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]

TA502396AM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACOT12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A11]

TA502396BM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

TA502396S

USD 159.00

2 Days

ACOT12 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1B9]

TA502462

USD 379.00

In Stock

ACOT12 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACOT12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]

TA502462AM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACOT12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]

TA502462BM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1B9]

TA502462S

USD 159.00

2 Days

ACOT12 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

TA502477

USD 379.00

In Stock

ACOT12 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ACOT12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D11]

TA502477AM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), Biotinylated

Applications	FC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

ACOT12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]

TA502477BM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), HRP conjugated

Applications	FC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

TA502477S

USD 159.00

2 Days

ACOT12 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1D3]

TA502530

USD 379.00

In Stock

ACOT12 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]

TA502530AM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3), Biotinylated

Applications	FC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D3]

TA502530BM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3), HRP conjugated

Applications	FC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1D3]

TA502530S

USD 159.00

2 Days

ACOT12 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA502686

USD 379.00

In Stock

ACOT12 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]

TA502686AM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated

Applications	FC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F10]

TA502686BM

USD 420.00

4 Weeks

ACOT12 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated

Applications	FC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA502686S

USD 159.00

2 Days

ACOT12 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 27 of 27 results