PAK4 (NM_001014832) Human Recombinant Protein
CAT#: TP317097
Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217097 protein sequence
Red=Cloning site Green=Tags(s) MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKTI VRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAG HSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPLSGPDVGTPQPAGLASGAKLAAGRPFNTYPR ADTDHPSRGAQGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAA PAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK KMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRL PYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQR ATAAELLKHPFLAKAGPPASIVPLMRQNRTR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 63.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001014832 |
| Locus ID | 10298 |
| UniProt ID | O96013, A0A024R0J1 |
| Cytogenetics | 19q13.2 |
| Refseq Size | 2765 |
| Refseq ORF | 1773 |
| Summary | PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Axon guidance, ErbB signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417002 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423086 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423087 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423088 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425369 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425370 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY417002 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1 |
USD 436.00 |
|
| LY423086 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2 |
USD 436.00 |
|
| LY423087 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3 |
USD 436.00 |
|
| LY423088 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 5 |
USD 665.00 |
|
| LY425369 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3 |
USD 396.00 |
|
| LY425370 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 5 |
USD 396.00 |
|
| PH302302 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_005875) |
USD 2,055.00 |
|
| PH306847 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014831) |
USD 2,055.00 |
|
| PH317097 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014832) |
USD 2,055.00 |
|
| TP302302 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1 |
USD 867.00 |
|
| TP306847 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2 |
USD 823.00 |
|
| TP723905 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 10 µg |
USD 265.00 |
|
| TP723906 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 100 µg |
USD 820.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China