PAK4 (NM_005884) Human Recombinant Protein

CAT#: TP723906

Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 100 µg


  View other "PAK4" proteins (19)

USD 820.00

5 Days*

Size
    • 100 ug

Product Images

Other products for "PAK4"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Tag Tag Free
Predicted MW 33.3 kDa
Concentration 1 mg/ml
Purity >90% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Bioactivity Specific activity was determined as 5,595 pmoles/min/µg, according to the Zlyte assay protocol
Endotoxin < 0.1 ng/µg of protein (< 1EU/µg)
Storage Store at -80°C.
Stability Stable at -80°C for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -80°C.
Reference Data
RefSeq NP_005875
Locus ID 10298
UniProt ID O96013, A0A024R0J1
Cytogenetics 19q13.2
Refseq Size 2838
Refseq ORF 1773
Synonyms p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A)-activated kinase 4; p21-activated kinase 4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
Summary PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Axon guidance, ErbB signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.