PAK4 (NM_005884) Human Recombinant Protein

CAT#: TP723905

Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 10 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
• Tag: Tag Free
• Predicted MW: 33.3 kDa
• Concentration: 1 mg/ml
• Purity: >90% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
• Bioactivity: Specific activity was determined as 5,595 pmoles/min/µg, according to the Zlyte assay protocol
• Endotoxin: < 0.1 ng/µg of protein (< 1EU/µg)
• Storage: Store at -80°C.
• Stability: Stable at -80°C for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -80°C.

Reference Data

• RefSeq: NP_005875
• Locus ID: 10298
• UniProt ID: O96013, A0A024R0J1
• Cytogenetics: 19q13.2
• Refseq Size: 2838
• Refseq ORF: 1773
• Synonyms: p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A)-activated kinase 4; p21-activated kinase 4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
• Summary: PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Axon guidance, ErbB signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway