MICA (NM_001177519) Human Recombinant Protein
CAT#: TP329900
Purified recombinant protein of Homo sapiens MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*00801).
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229900 representing NM_001177519
Red=Cloning site Green=Tags(s) MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQG QWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELF LSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVN VTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRF TCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAGCCYFCYYYFLCPLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.3 |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001170990 |
Locus ID | 100507436 |
UniProt ID | Q96QC4 |
Cytogenetics | 6p21.33 |
Refseq ORF | 996 |
Synonyms | MIC-A; PERB11.1 |
Summary | This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400095 | MICA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432900 | MICA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400095 | Transient overexpression lysate of MHC class I polypeptide-related sequence A (MICA) |
USD 396.00 |
|
LY432900 | Transient overexpression lysate of MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*00801) |
USD 396.00 |
|
PH304447 | MICA MS Standard C13 and N15-labeled recombinant protein (NP_000238) |
USD 2,055.00 |
|
TP304447 | Recombinant protein of human MHC class I polypeptide-related sequence A (MICA) |
USD 823.00 |
|
TP720672 | Purified recombinant protein of Human MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*001) |
USD 330.00 |
|
TP720954 | Purified recombinant protein of Human MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*001) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review