CD47 (NM_198793) Human Recombinant Protein
CAT#: TP720635
Purified recombinant protein of Human CD47 molecule (CD47), transcript variant 2
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDHHHHHH
|
Tag | C-His |
Predicted MW | 14.76 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_942088 |
Locus ID | 961 |
UniProt ID | Q08722 |
Cytogenetics | 3q13.12 |
Refseq Size | 5288 |
Refseq ORF | 915 |
Synonyms | IAP; MER6; OA3 |
Summary | This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | ECM-receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404792 | CD47 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419754 | CD47 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430763 | CD47 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404792 | Transient overexpression lysate of CD47 molecule (CD47), transcript variant 2 |
USD 325.00 |
|
LY419754 | Transient overexpression lysate of CD47 molecule (CD47), transcript variant 1 |
USD 325.00 |
|
LY430763 | Transient overexpression lysate of CD47 molecule (CD47), transcript variant 2 |
USD 325.00 |
|
TP700196 | Purified recombinant protein of Homo sapiens CD47 molecule (CD47), residues 19-141aa, with C-terminal Fc tag, expressed in HEK293 cells. |
USD 748.00 |
|
TP700197 | Purified recombinant protein of Homo sapiens CD47 molecule (CD47), residues 19-141aa, with C-terminal DDK/His tag, expressed in HEK293 cells. |
USD 748.00 |
|
TP710231 | Purified recombinant protein of Human CD47 molecule (CD47), transcript variant 1, residues 19-141aa, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
TP720959 | Purified recombinant protein of Human CD47 molecule (CD47), transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review