CD47 (NM_198793) Human Recombinant Protein

CAT#: TP720635

Purified recombinant protein of Human CD47 molecule (CD47), transcript variant 2


  View other "CD47" proteins (10)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "CD47"

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDHHHHHH
Tag C-His
Predicted MW 14.76 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_942088
Locus ID 961
UniProt ID Q08722
Cytogenetics 3q13.12
Refseq Size 5288
Refseq ORF 915
Synonyms IAP; MER6; OA3
Summary This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]
Protein Families Druggable Genome, Transmembrane
Protein Pathways ECM-receptor interaction

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.