Csf1 (NM_001113529) Mouse Recombinant Protein
CAT#: TP723289
Purified recombinant protein of Mouse colony stimulating factor 1 (macrophage) (Csf1), transcript variant 2.
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
|
| Tag | Tag Free |
| Predicted MW | 36.4 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | The ED50 as determined by the dose-dependent stimulation of the proliferation of M-NFS-60 cells is > 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_031804 |
| Locus ID | 12977 |
| UniProt ID | P07141 |
| Cytogenetics | 3 46.83 cM |
| Refseq Size | 3307 |
| Refseq ORF | 771 |
| Synonyms | C87615; Csfm; MCSF; op |
| Summary | Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. [UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP526827 | Purified recombinant protein of Mouse colony stimulating factor 1 (macrophage) (Csf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
| TP721033 | Csf1 (Myc-DDK-tagged ORF) - Rat colony stimulating factor 1 (macrophage) (Csf1), (10 ug) |
USD 330.00 |
|
| TP723290 | Purified recombinant protein of Rat colony stimulating factor 1 (macrophage) (Csf1). |
USD 240.00 |
|
| TP723754 | Purified recombinant protein of Mouse colony stimulating factor 1 (macrophage) (Csf1), transcript variant 3 |
USD 160.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China