Csf1 (NM_023981) Rat Recombinant Protein

CAT#: TP723290

Purified recombinant protein of Rat colony stimulating factor 1 (macrophage) (Csf1).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
• Tag: Tag Free
• Predicted MW: 18.1 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than or equal to 5.0 ng/ml, corresponding to a specific activity of >2 x 10^5 units/mg.
  Cell culture factor (PMID: 30022569)
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076471
• Locus ID: 78965
• UniProt ID: Q6GMN4
• Cytogenetics: 2q34
• Refseq Size: 3975
• Refseq ORF: 1698
• Summary: plays a role in macrophage formation; involved in osteoclastogenesis and endochondral ossification [RGD, Feb 2006]