Rabbit Polyclonal Anti-ACAA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL |
Rabbit Polyclonal Anti-ACSL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the middle region of Human ACSL6. Synthetic peptide located within the following region: GPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFE |
Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS |
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD |
Rabbit Polyclonal Anti-ADH6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
Rabbit Polyclonal Anti-ACSL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ACSL6. Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS |
Rabbit Polyclonal Anti-HADHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HADHB antibody: synthetic peptide directed towards the C terminal of human HADHB. Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE |
Rabbit Polyclonal Anti-DCI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCI antibody: synthetic peptide directed towards the N terminal of human DCI. Synthetic peptide located within the following region: ALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEP |
Rabbit Polyclonal Anti-PECI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PECI antibody: synthetic peptide directed towards the middle region of human PECI. Synthetic peptide located within the following region: AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK |
Germany
Japan
United Kingdom
China
