Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit Polyclonal Anti-RCOR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS |
Rabbit Polyclonal Anti-RCOR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS |
Rabbit Polyclonal Anti-POLR2C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Polr2c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Polr2c. Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
Rabbit Polyclonal Anti-POLR2K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2K antibody: synthetic peptide directed towards the middle region of human POLR2K. Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR |
Rabbit Polyclonal Anti-POLR2H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2H antibody: synthetic peptide directed towards the N terminal of human POLR2H. Synthetic peptide located within the following region: DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE |
Germany
Japan
United Kingdom
China
