Rabbit Polyclonal Anti-SDHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Rabbit Polyclonal Anti-ATP2A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Rabbit Polyclonal Anti-ATP5F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST |
Rabbit Polyclonal Anti-NDUFV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL |
Rabbit Polyclonal Anti-ATP5G2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5G2 antibody: synthetic peptide directed towards the N terminal of human ATP5G2. Synthetic peptide located within the following region: SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA |
Rabbit Polyclonal Anti-LCMT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
Germany
Japan
United Kingdom
China
