Rabbit Polyclonal Anti-RAD23A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD23A antibody: synthetic peptide directed towards the N terminal of human RAD23A. Synthetic peptide located within the following region: VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN |
Rabbit Polyclonal Anti-RAD23A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD23A antibody: synthetic peptide directed towards the middle region of human RAD23A. Synthetic peptide located within the following region: GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-ERCC4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC4 antibody: synthetic peptide directed towards the middle region of human ERCC4. Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST |
Rabbit Polyclonal Anti-POLE3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLE3 antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT |
Rabbit Polyclonal Anti-ERCC8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFD |
Rabbit Polyclonal Anti-POLE4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV |
Rabbit Polyclonal Anti-POLD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Germany
Japan
United Kingdom
China
