Rabbit anti-SFRS1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SFRS1 |
Rabbit anti-SFRS1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SFRS1 |
Rabbit Polyclonal Anti-SFRS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the middle region of human SFRS1. Synthetic peptide located within the following region: GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS |
Rabbit Polyclonal Anti-SFRS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the C terminal of human SFRS1. Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR |
SF2 (SRSF1) (C-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 165~194 amino acids from the C-terminal region of Human SFRS1 |
SRSF1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRSF1 |
SF2 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human SF2 |
SF2 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |