Primary Antibodies

View as table Download

Rabbit polyclonal anti-Cyclin A antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-Cyclin-A Antibody was produced by repeated immunizations with a recombinant protein corresponding to the human cyclin A.

Rabbit Polyclonal Cyclin A2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal anti-Ccna2 antibody

Applications WB
Reactivities Human, Rat
Immunogen The immunogen for anti-Ccna2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET

Rabbit Polyclonal Anti-CCNA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2. Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

Rabbit anti Cyclin A Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CCNA2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of Human CCNA2

Cyclin A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Cyclin A2 (NP_001228.1).
Modifications Unmodified

Cyclin A2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human Cyclin A2
Modifications Unmodified

Cyclin A1/A2 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Cyclin A1/A2

Rabbit polyclonal anti-CCNA2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCNA2

Rabbit polyclonal anti-CCNA2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCNA2