Primary Antibodies

View as table Download

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

EGF rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human EGF

Biotinylated Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Anti-Rat EGF Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Rat EGF

Rabbit polyclonal anti rec EGF (hu); neat antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti rec EGF (hu); purified rabbit IgG

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asn-Ser-Asp-Ser-Glu-Cys-Pro-Leu-Ser-His-Asp- Gly-Tyr-Cys-Leu-His-Asp-Gly-Val-Cys-Met-Tyr-Ile-Glu-Ala-Leu-Asp-Lys- Tyr-Ala-Cys-Asn-Cys-Val-Val-Gly-Tyr-Ile-Gly-Glu-Arg-Cys-Gln-Tyr-Arg- Asp-Leu-Lys-Trp-Trp-Glu-Leu-Arg-OH (Disulfide bonds between Cys⁶ and Cys²⁰/Cys¹⁴ and Cys³¹/Cys³³ and Cys⁴²) coupled to a carrier protein.

Anti-EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

EGF Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-250 of human EGF (NP_001954.2).
Modifications Unmodified

EGF Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 850-950 of human EGF (NP_001954.2).
Modifications Unmodified