Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit polyclonal NFKBp65 Antibody (C-term S536)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NFKBp65 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 517-539 amino acids from the C-terminal region of human NFKBp65. |
Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702) |
Rabbit polyclonal Akt2 (PKB beta) Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | A five residue synthetic peptide based on the human Akt2, coupled to KLH |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Germany
Japan
United Kingdom
China
