Rabbit Polyclonal Anti-Aqp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV |
Rabbit Anti-Aquaporin 2 (Ser261) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser261 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Anti-Aquaporin 2 (Ser264) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser264 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Anti-Aquaporin 2 (Ser 269) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser269 conjugated to KLH |
| Modifications | Phospho-specific |
Anti-AQP2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2 |
Anti-AQP2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2 |
AQP2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 147-271 of human AQP2 (NP_000477.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
