Rabbit anti-RAB5A Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAB5A |
Rabbit anti-RAB5A Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAB5A |
Rabbit polyclonal Rab5 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Monkey, Bovine, Rat. Not tested in other species |
Conjugation | Unconjugated |
Immunogen | Human Rab5 synthetic peptide conjugated to KLH; identical to dog Rab5 sequence over the residues |
Rabbit polyclonal Rab5 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5. |
Rabbit Polyclonal Anti-Rab5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rab5 Antibody: Peptide sequence around aa.188~192( N-P-G-A-N) derived from Human Rab5. |
Rabbit Polyclonal Anti-Rab5A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rab5A Antibody: A synthesized peptide derived from human Rab5A |
Rabbit polyclonal Anti-RAB5A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Rabbit polyclonal Rab4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat. Not yet tested on other species |
Conjugation | Unconjugated |
Immunogen | C-terminal peptide from human Rab4 |
Rabbit polyclonal Anti-RAB5A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS |
Anti-RAB5A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Anti-RAB5A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Rab5a Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rab5a Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rab5 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Rab5 |
Rab5 Rabbit monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rab5 Rabbit monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |