Primary Antibodies

View as table Download

Rabbit polyclonal antibody to L3MBTL (l(3)mbt-like (Drosophila))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 365 and 723 of L3MBTL

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-L3MBTL Antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: RRREGHGTDSEMGQGPVRESQSSDPPALQFRISEYKPLNMAGVEQPPSPE

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L3MBTL antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS

L3mbtl Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl

L3mbtl Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl

L3MBTL1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human LMBL1

L3MBTL1 Antibody - N-terminal

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-L3MBTL1 antibody is: synthetic peptide directed towards the N-terminal of Human LMBL1

Recombinant Anti-L3MBTL1 (Clone RAB-C213)

Applications ChIP, ELISA, FC, IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques.