Rabbit Polyclonal RIPK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1. |
Rabbit Polyclonal RIPK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1. |
RIP (RIPK1) (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
RIP (RIPK1) (C-term) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Rabbit Polyclonal RIP1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | RIP1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human RIP1. |
Rabbit Polyclonal Anti-RIPK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ |
RIPK1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RIPK1 |
RIPK1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RIPK1 |
RIPK1/RIP Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-440 of human RIPK1/RIP (NP_003795.2). |
Modifications | Unmodified |
Phospho-RIPK1-S166 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S166 of Mouse RIPK1. |
Modifications | Phospho S166 |
RIP Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |