Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Anti-Hdac4 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL |
Rabbit Polyclonal Anti-MED6 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN |
Rabbit Polyclonal Anti-Thrb Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
Active filters
Reactivities
- Mouse
Applications
- Assay
Families
- Druggable Genome
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Pathways
- Pathways in cancer (3)
- ErbB signaling pathway (2)
- Focal adhesion (2)
- MAPK signaling pathway (2)
- Small cell lung cancer (2)
- Wnt signaling pathway (2)
- ABC transporters (1)
- Acute myeloid leukemia (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Cell cycle (1)
- Chronic myeloid leukemia (1)
- Colorectal cancer (1)
- Dilated cardiomyopathy (1)
- ECM-receptor interaction (1)
- Endometrial cancer (1)
- Fc gamma R-mediated phagocytosis (1)
- Gap junction (1)
- Glioma (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Jak-STAT signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Melanogenesis (1)
- Metabolic pathways (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Non-small cell lung cancer (1)
- Phosphatidylinositol signaling system (1)
- Regulation of actin cytoskeleton (1)
- Retinol metabolism (1)
- Starch and sucrose metabolism (1)
- Systemic lupus erythematosus (1)
- TGF-beta signaling pathway (1)
- Thyroid cancer (1)
- Tight junction (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)