Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- Assay
Families
- ES Cell Differentiation/IPS
Filter by
Reactivities
Antibody Hosts
Clonalities
Conjugates
Pathways
- Cytokine-cytokine receptor interaction (8)
- Endocytosis (7)
- Leukocyte transendothelial migration (7)
- Pathways in cancer (7)
- Colorectal cancer (6)
- Focal adhesion (6)
- Axon guidance (5)
- Chemokine signaling pathway (5)
- Adherens junction (4)
- Endometrial cancer (4)
- MAPK signaling pathway (4)
- Prostate cancer (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- ErbB signaling pathway (3)
- GnRH signaling pathway (3)
- Pancreatic cancer (3)
- Regulation of actin cytoskeleton (3)
- Wnt signaling pathway (3)
- Basal cell carcinoma (2)
- Bladder cancer (2)
- Calcium signaling pathway (2)
- Dilated cardiomyopathy (2)
- Dorso-ventral axis formation (2)
- Gap junction (2)
- Glioma (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Melanogenesis (2)
- Melanoma (2)
- Non-small cell lung cancer (2)
- Pathogenic Escherichia coli infection (2)
- Renal cell carcinoma (2)
- Thyroid cancer (2)
- Tight junction (2)
- Alzheimer's disease (1)
- B cell receptor signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Cell cycle (1)
- Chronic myeloid leukemia (1)
- ECM-receptor interaction (1)
- Glycolysis / Gluconeogenesis (1)
- Metabolic pathways (1)
- Neurotrophin signaling pathway (1)
- Small cell lung cancer (1)
- T cell receptor signaling pathway (1)
- TGF-beta signaling pathway (1)
- Toll-like receptor signaling pathway (1)