Primary Antibodies

View as table Download

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%).

TGFBI Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen TGFBI antibody was raised against synthetic peptide C-QLYTDRTEKLRPE from an internal region of human TGFBI (NP_000349.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Platypus (92%).

Rabbit Polyclonal Anti-HSD17B11 Antibody

Applications IHC
Reactivities Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG

GDF15 Goat Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen GDF15 antibody was raised against synthetic peptide C-QKTDTGVSLQTYDD from the C-terminus of human GDF15 (NP_004855.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset (93%).

Rabbit polyclonal antibody to Factor IX (coagulation factor IX)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 217 and 453 of Factor IX (Uniprot ID#P00740)

ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish
Conjugation Unconjugated
Immunogen ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C.

Anti-IGFBP-5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%).

WNT2B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%).

Rabbit polyclonal TTR Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR.

Rabbit polyclonal CCL2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2.

Rabbit Polyclonal Anti-DPP4 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DPP4 / CD26 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human CD26. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey (100%); Orangutan, Galago, Marmoset, Horse (94%); Elephant, Dog, Pig (89%); Panda, Cat (83%).

Rabbit Polyclonal Antibody against APOE (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APOE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the C-terminal region of human APOE.

PACE4 / PCSK6 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen PACE4 / PCSK6 antibody was raised against synthetic peptide PDCEPGTYFDSE from an internal region of human PCSK6 / PACE4 (NP_002561.1; NP_612192.1; NP_612195.1; NP_612197.1; NP_612196.1; NP_612198.2; NP_612193.1; NP_612194.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Panda (92%); Platypus, Poplar (83%).

Osteopontin Goat Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen SPP1 / Osteopontin antibody was raised against synthetic peptide C-DPKSKEEDKHLK from the C-terminus of human SPP1 / Osteopontin (NP_001035147.1; NP_000573.1; NP_001035149.1). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset (92%); Mouse, Panda, Dog, Pig, Arthrobotrys (83%).

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Rabbit Polyclonal Anti-PIGR Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen PIGR antibody was raised against synthetic 19 amino acid peptide from extracellular domain of human PIGR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (95%); Orangutan, Marmoset (89%).

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).

Rabbit Polyclonal Anti-FLT1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen FLT1 / VEGFR1 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human VEGFR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Dog, Panda, Horse, Opossum (93%); Mouse, Rat, Platypus (87%); Bovine, Elephant, Rabbit (80%).

Rabbit Polyclonal Anti-WNT16 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT16 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Mouse, Rat, Hamster (100%); Gorilla, Monkey, Marmoset (94%); Gibbon, Elephant, Panda, Dog, Horse, Turkey (88%); Bovine, Rabbit, Opossum, Platypus (81%).

TLL2 Rabbit Polyclonal (CUB 2 Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Dog, Human, Monkey, Pig, Rat
Conjugation Unconjugated
Immunogen TLL2 antibody was raised against synthetic 13 amino acid peptide from CUB 2 domain human TLL2. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Galago, Marmoset, Rat, Dog, Bat, Pig (100%); Gorilla, Hamster, Panda (92%); Mouse, Horse (85%).

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).

WNT8A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Horse, Human, Monkey
Conjugation Unconjugated
Immunogen WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%).

WNT8B / Wnt 8b Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen WNT8B / Wnt 8b antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Dog, Bat, Horse, Rabbit (94%); Bovine (88%); Elephant (82%).

WNT14 / WNT9A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen WNT14 / WNT9A antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human WNT9A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Mouse, Rat, Bovine, Bat, Rabbit (94%).

WNT10A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%).

WNT9B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen WNT9B / WNT15 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT9B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig (100%); Bat, Rabbit (94%); Dog (88%).

WNT10A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Rabbit
Conjugation Unconjugated
Immunogen WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%).

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 17 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Elephant, Horse (94%); Bat, Pig (88%); Mouse, Rat, Hamster, Rabbit (82%).

WNT11 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%).

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%).

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%).

Rabbit Polyclonal Anti-DKK1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DKK1 antibody was raised against synthetic 15 amino acid peptide from 1st cytoplasmic domain of human DKK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (80%).

Rabbit Polyclonal Anti-DPP4 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DPP4 / CD26 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human CD26. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey (100%); Gorilla, Marmoset, Bovine (93%); Cat, Rabbit (87%); Dog, Bat, Elephant, Panda, Horse (80%).

Rabbit Polyclonal Anti-WNT5B Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT5B antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey (100%); Gorilla, Marmoset (93%); Dog, Elephant, Horse, Rabbit, Opossum (86%).

Rabbit Polyclonal Anti-ADAMTS1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 17 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Orangutan, Monkey, Marmoset (94%); Gibbon (88%).

Rabbit Polyclonal Anti-WNT16 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT16 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Horse (93%); Hamster, Elephant, Pig (87%); Mouse, Rat, Panda, Dog, Bat, Rabbit, Lizard (80%).

Rabbit Polyclonal Anti-WNT5B Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT5B antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Marmoset, Bovine, Dog, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Gibbon, Monkey, Mouse, Rat, Opossum (93%); Hamster (87%); Xenopus (80%).

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12)

Applications IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10)

Applications IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI11G2 (formerly 11G2)

Applications IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AFP mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB3 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications Assay, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TIMP2 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TIMP2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINE2 mouse monoclonal antibody, clone OTI6F3 (formerly 6F3)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KLK8 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated