Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FBL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBL antibody: synthetic peptide directed towards the N terminal of human FBL. Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

FBL Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Monkey, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FBL

Mouse Monoclonal Fibrillarin Antibody (38F3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Chicken, Drosophila
Conjugation Unconjugated

Fibrillarin Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Fibrillarin