Primary Antibodies

Jump to Filters
View as table Download
Nestin (NES) Rabbit Polyclonal Antibody
TA344204

USD 475.00

5 Days

Rabbit Polyclonal Anti-NES Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NES antibody: synthetic peptide directed towards the middle region of human NES. Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
Nestin (NES) Rabbit Polyclonal Antibody
TA324694

USD 450.00

5 Days

Rabbit polyclonal Nestin Antibody (S1409)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Nestin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1389-1416 amino acids from human Nestin.
Nestin (NES) Rabbit Polyclonal Antibody
TA319444

USD 530.00

5 Days

Rabbit polyclonal anti-Nestin antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1484-1500 of human Nestin protein.
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI3B12]
CF809183

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NES mouse monoclonal antibody,clone OTI3B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF809210

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NES mouse monoclonal antibody, clone OTI1B4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Nestin (NES) Rabbit Polyclonal Antibody
TA350891

USD 345.00

In Stock

Rabbit Polyclonal Anti-NES Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NES
Nestin (NES) Rabbit Polyclonal Antibody
TA351663

USD 345.00

In Stock

Rabbit Polyclonal Anti-NES Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NES
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI3B12]
TA809183

USD 379.00

In Stock

NES mouse monoclonal antibody,clone OTI3B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI3B12]
TA809183S

USD 159.00

2 Days

NES mouse monoclonal antibody,clone OTI3B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
TA809210

USD 379.00

In Stock

NES mouse monoclonal antibody,clone OTI1B4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Nestin (NES) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]
TA809210AM

USD 420.00

4 Weeks

NES mouse monoclonal antibody,clone OTI1B4, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
TA809210S

USD 159.00

2 Days

NES mouse monoclonal antibody,clone OTI1B4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Nestin (NES) Mouse Monoclonal Antibody [Clone ID: UMAB267]
UM800157

USD 468.00

In Stock

NES mouse monoclonal antibody,clone UMAB267

Applications IHC
Reactivities Human
Conjugation Unconjugated
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: UMAB267]
UM800157CF

USD 528.00

3 Weeks

Carrier-free (BSA/glycerol-free) NES mouse monoclonal antibody,clone UMAB267

Applications IHC
Reactivities Human
Conjugation Unconjugated