Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit anti-CNP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CNP |
CNPase (CNP) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH conjugated corresponded to a region of the CNPase gene product shared between the Human (NP_149124) and Mouse (P16330) sequences. After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. |
Rabbit Polyclonal Anti-CNP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- CNP
Applications
- IHC