Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF

Rabbit Polyclonal Anti-Tyrp1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN

TYRP1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse TYRP1