Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

Goat Anti-CPT1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KSSTKTDSHRLGQH, from the internal region of the protein sequence according to NP_689572.1; NP_001129524.1.

Goat Polyclonal Antibody against SOCS3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PIREFLDQYDAPL, from the C Terminus of the protein sequence according to NP_003946.3.

Goat Polyclonal Antibody against STAT3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence DMELTSECATSPM, from the C Terminus of the protein sequence according to NP_003141.2; NP_644805.1.

Goat Anti-PRKAA2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2.

Rabbit polyclonal NFKBp65 Antibody (C-term S536)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NFKBp65 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 517-539 amino acids from the C-terminal region of human NFKBp65.

Goat Polyclonal Antibody against RXR beta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811.

Goat Polyclonal Antibody against RXR gamma

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848.

Goat Polyclonal Antibody against SHP2 / PTPN11

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-YENVGLMQQQKSFR, from the C Terminus of the protein sequence according to NP_002825.3.

Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702)

Goat Anti-TNFRSF1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1.

Goat Anti-FACL4 / ACSL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1.

Rabbit polyclonal Akt2 (PKB beta) Antibody

Applications WB
Reactivities Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig
Conjugation Unconjugated
Immunogen A five residue synthetic peptide based on the human Akt2, coupled to KLH

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS