Primary Antibodies

View as table Download

Rabbit Polyclonal TLR2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2.

Rat Monoclonal TLR2 Antibody (11G5)

Applications FC, WB
Reactivities Mouse
Conjugation Unconjugated

TLR2 rabbit polyclonal antibody

Applications IHC, WB
Conjugation Unconjugated

Rabbit Polyclonal anti-TLR2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Rabbit Polyclonal TLR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a mixture of synthetic peptides containing amino acids 180-196, 353-370, and 473-489 of human TLR2 (NP_003255).

Rabbit Polyclonal TLR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against an extracellular domain of mouse TLR2 (amino acids 564-580 and 751-770).

Rabbit Polyclonal Anti-TLR2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TLR2