Primary Antibodies

View as table Download

Rabbit polyclonal antibody to ESE1 (E74-like factor 3 (ets domain transcription factor, epithelial-specific ))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 309 and 371 of ESE1 (Uniprot ID#P78545)

Rabbit Polyclonal Anti-Elf3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of mouse Elf3. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP

Rabbit Polyclonal Anti-Elf3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the N terminal of mouse Elf3. Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL

Goat Polyclonal Antibody against ELF3 / ERT/ ESX

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SGWKEEEVLQSRN, from the C Terminus of the protein sequence according to NP_004424.2.

Rabbit Polyclonal anti-Elf3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of human Elf3. Synthetic peptide located within the following region: GSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDG

Rabbit Polyclonal Anti-ELF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELF3 antibody: synthetic peptide directed towards the middle region of human ELF3. Synthetic peptide located within the following region: PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSD

Rabbit Polyclonal Anti-Elf3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP

ESE1/ELF3 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESE1/ESE1/ELF3 (NP_004424.3).
Modifications Unmodified

ESE1/ELF3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESE1/ESE1/ELF3 (NP_004424.3).
Modifications Unmodified