Primary Antibodies

View as table Download

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Rabbit polyclonal anti-PGC-1alpha antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha

Rabbit Polyclonal Anti-PPARGC1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS

Rabbit Polyclonal Anti-MALT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MALT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human MALT1.

Rabbit anti-PPARGC1A polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human PGC-1.

Rabbit Polyclonal Anti-Ppargc1a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppargc1a antibody: synthetic peptide directed towards the middle region of mouse Ppargc1a. Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL

Rabbit Polyclonal Anti-Ppargc1a Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppargc1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD

Goat Polyclonal Antibody against PPARGC1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DGLFDDSEDESDK, from the internal region of the protein sequence according to NP_037393.1.

Rabbit Polyclonal anti-PPARGC1A antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL

Rabbit Polyclonal Anti-PPARGC1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PPARGC1A

PGC1α Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human PGC1α (NP_037393.1).
Modifications Unmodified

PGC1α Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human PGC1α (NP_037393.1).
Modifications Unmodified

PGC1 alpha Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of mouse PGC1 alpha (NP_032930.1).