Primary Antibodies

View as table Download

CCR4 mouse monoclonal antibody, clone KH-4F5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

CCR4 (Extracell. Dom.) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic corresponding to Human CCR4 extracellular domain.
Epitope: Extracellular Domain.

Rabbit Polyclonal Anti-CCR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL

CCR4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Human, Mouse
Immunogen Synthetic peptide surrounding amino acid 32 of human CCR4

CCR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR4 (NP_005499.1).