Rabbit Polyclonal Anti-DDC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal Anti-DDC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC. Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL |
Goat Polyclonal Antibody against DOPA decarboxylase
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-WEHIKELAADVL, from the C Terminus of the protein sequence according to NP_000781.1. |
Rabbit Anti-DOPA Decarboxylase, Bovine Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | SDS denatured, recombinant bovine aromatic DOPA decarboxylase expressed in E. coli and purified from inclusion bodies |
DDC rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DDC |
DDC Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DDC (NP_000781.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
