Primary Antibodies

Jump to Filters
View as table Download
MAFA (Center) Rabbit Polyclonal Antibody
AP52582PU-N

USD 450.00

2 Weeks

MAFA (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 209~238 amino acids from the Central region of Human MAFA.
MAFA (C-term) Rabbit Polyclonal Antibody
AP52583PU-N

USD 450.00

2 Weeks

MAFA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285-315 amino acids from the C-terminal region of human MAFA
MAFA (C-term) Rabbit Polyclonal Antibody
AP52584PU-N

USD 450.00

2 Weeks

MAFA (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 288~318 amino acids from the C-terminal region of human MAFA
Mafa Rabbit Polyclonal Antibody
TA331438

USD 375.00

5 Days

Rabbit polyclonal Anti-Mafa Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK
Mafa Rabbit Polyclonal Antibody
TA331439

USD 375.00

5 Days

Rabbit polyclonal Anti-Mafa Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALN
MAFA Rabbit Polyclonal Antibody
TA342515

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAFA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAA
MAFA Rabbit Polyclonal Antibody
TA342516

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS
MAFA Rabbit Polyclonal Antibody
TA367498

USD 380.00

4 Weeks

MAFA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAFA