Primary Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

USD 450.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.

Rabbit Polyclonal Anti-ITGB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB3

Rabbit Polyclonal Anti-LMNA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LMNA

USD 320.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.

Mouse Monoclonal anti-CACNA1C Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal anti-CACNA1D Antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.

USD 320.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

Rabbit Polyclonal antibody to beta Actin (actin, beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1

Rabbit Polyclonal N Cadherin Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 300.00

In Stock

Goat Polyclonal Anti-CDH2 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 850 aa to C-terminus of human CDH2 produced in E. coli.

Rabbit polyclonal ITGB4 (Ab-1510) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T).

Goat Anti-Desmin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDGEVVSEATQQQHE, from the C Terminus of the protein sequence according to NP_001918.3.

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN

Rabbit Polyclonal Anti-ACTB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTB

Rabbit polyclonal Actinin alpha-2/3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Actinin a-2/3.

CTNNB1 Capture mouse monoclonal antibody, Luminex validated, clone OTI2H3

Applications ELISA, LMNX
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Matched ELISA Pair TA700034

USD 320.00

In Stock

Goat Polyclonal Anti-LMNA Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 620 aa to C-term of human LMNA produced in E. coli.

Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229)

Rabbit polyclonal Integrin Beta5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Integrin β5.

Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V).
Modifications Phospho-specific

Rabbit polyclonal anti-Plakoglobin / Catenin-gamma antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Catenin-?.

Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N).
Modifications Phospho-specific

Rabbit polyclonal Shc (Ab-349) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N).

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.

Rabbit polyclonal anti-NOM1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOM1.

Rabbit polyclonal anti-TCF7L1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TCF7L1.

Rabbit polyclonal Lamin A (Cleaved-Asp230) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Lamin A.

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1

Rabbit Polyclonal Integrin alpha 6 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal CACNB2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

CTNNB1 Capture mouse monoclonal antibody, Luminex validated, clone OTI9F6

Applications LMNX
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Matched ELISA Pair TA700034

Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265.
Modifications Phospho-specific

Rabbit polyclonal ITGA6 (light chain, Cleaved-Glu942) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGA6.
Modifications Phospho-specific

Rabbit polyclonal anti-ACTN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1.

Rabbit polyclonal ITGA5 (heavy chain, Cleaved-Phe42) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGA5.

Rabbit polyclonal Integrin beta1 (Ab-789) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V).

Rabbit polyclonal Catenin-beta (Ab-489) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).

Rabbit polyclonal anti-ACTN3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN3.

Rabbit polyclonal ITGA7 (light chain, Cleaved-Glu959) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Integrin alpha-7 light chain.

Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGAV.