Primary Antibodies

View as table Download

Enkephalin (PENK) rabbit polyclonal antibody

Applications IHC
Reactivities Mouse, Rat
Conjugation Unconjugated

Enkephalin (PENK) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Birds, Mammalian
Conjugation Unconjugated
Immunogen Synthetic methionine enkephalin coupled to bovine thyroglobulin (BTg) with glutaraldehyde.

Rabbit Polyclonal Anti-PENK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Rabbit polyclonal anti Met-Enkephalin; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein.

Enkephalin (PENK) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated
Immunogen Synthetic leucine enkephalin coupled to keyhole limpet hemocyanin (KLH) to bovine thyroglobulin and BSA with glutaraldehyde.

Goat Polyclonal Antibody against PENK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSHHQDGSDNEE, from the internal region of the protein sequence according to NP_006202.1.

Rabbit polyclonal anti BAM-12P; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to a carrier protein.

Rabbit polyclonal anti BAM-22P; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein.

Rabbit polyclonal anti BAM-22P; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein.

Rabbit polyclonal anti BAM-12P; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to carrier protein.

Rabbit polyclonal anti Leu-Enkephalin; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein.

Rabbit polyclonal anti Leu-Enkephalin; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Leu-Enkephalin; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Met-Enkephalin; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to a carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Peptide F (bo); purified rabbit IgG

Applications ELISA
Reactivities Bovine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr- Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg- Tyr-Gly-Gly-Phe-Met-OH coupled to a carrier protein.

Rabbit polyclonal anti Peptide F (bo); neat antiserum

Applications ELISA
Reactivities Bovine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr- Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg- Tyr-Gly-Gly-Phe-Met-OH coupled to carrier protein.

PENK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human PENK (NP_001129162.1).
Modifications Unmodified