Primary Antibodies

View as table Download

MINPP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 35-63 amino acids from the N-terminal region of Human MINPP1

Rabbit polyclonal anti-MINPP1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MINPP1.

Rabbit polyclonal antibody to MIPP (multiple inositol polyphosphate histidine phosphatase, 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 246 and 487 of MIPP (Uniprot ID#Q9UNW1)

Rabbit Polyclonal Anti-MINPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL

Carrier-free (BSA/glycerol-free) MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Purified MINPP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated