Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SELPLG Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SELPLG

SELPLG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SELPLG

CD162 (SELPLG) mouse monoclonal antibody, clone TC2, Aff - Purified

Applications FC, IHC
Reactivities Human

CD162 (SELPLG) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 386-413 amino acids from the C-terminal region of Human SELPLG

CD162 (SELPLG) mouse monoclonal antibody, clone TC2, APC

Applications FC
Reactivities Human
Conjugation APC

CD162 (SELPLG) mouse monoclonal antibody, clone TC2, FITC

Applications FC
Reactivities Human
Conjugation FITC

CD162 (SELPLG) mouse monoclonal antibody, clone TC2, PE

Applications FC
Reactivities Human
Conjugation PE

Rabbit Polyclonal Anti-SELPLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the C-terminal region of Human SELPLG. Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF

Rabbit Polyclonal Anti-SELPLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the N-terminal region of Human SELPLG. Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR