BCL2L2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCL2L2 |
BCL2L2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCL2L2 |
Rabbit anti-BCL2L2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BCL2L2 |
Rabbit polyclonal anti-BCL2L2 / BCLW antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BCLW. |
Rabbit Polyclonal anti-Bcl2l2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Bcl2l2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Bcl2l2. Synthetic peptide located within the following region: VQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR |
Rabbit anti BCL-w Polyclonal Antibody
Applications | WB |
Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from N-terminus of human BCL-W protein. This sequence is identical among human, rat and mouse origins. |
Anti-BCL2L2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-188 amino acids of human BCL2-like 2 |
BCL2L2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCL2L2 |