Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit anti-PRKG1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKG1 |
Rabbit Polyclonal Anti-OR10X1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR10X1 antibody: synthetic peptide directed towards the middle region of human OR10X1. Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-OR5T2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR5T2 antibody: synthetic peptide directed towards the C terminal of human OR5T2. Synthetic peptide located within the following region: DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK |
Rabbit Polyclonal Anti-KAPC A/B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KAPC A/B Antibody: A synthesized peptide derived from human KAPC A/B |
OR51L1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Olfactory receptor 51L1 |
Rabbit polyclonal anti-KAPCG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAPCG. |
Rabbit polyclonal anti-CaMK2 beta/gamma antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CaMK2β/?. |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Rabbit polyclonal anti-KAPC A/B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAPC A/B. |
Rabbit polyclonal anti-KAPCB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAPCB. |
Rabbit polyclonal anti-CGK 2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CGK 2. |
Rabbit polyclonal PKG2 (Ab-126) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKG2 around the phosphorylation site of serine 126 (G-V-SP-A-E). |
Rabbit polyclonal anti-OR2H2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2H2. |
Active filters
Category
- Antibodies
Pathways
- Olfactory transduction
Filter by
Target Symbol
- CAMK2B (29)
- GNAL (23)
- PRKG1 (15)
- PRKG2 (14)
- CAMK2A (11)
- CLCA1 (9)
- PRKACA (8)
- OR51E1 (7)
- GRK3 (6)
- CAMK2G (5)
- OR10J5 (5)
- OR2M2 (5)
- ARRB2 (4)
- CALM2 (4)
- OR10G9 (4)
- OR13C5 (4)
- PRKACB (4)
- CALM3 (3)
- CAMK2D (3)
- OR10A2 (3)
- OR10A6 (3)
- OR10G2 (3)
- OR10H4 (3)
- OR10J3 (3)
- OR10S1 (3)
- OR10X1 (3)
- OR1D2 (3)
- OR2AT4 (3)
- OR2F2 (3)
- OR2H2 (3)
- OR2J2 (3)
- OR2W3 (3)
- OR4A15 (3)
- OR4A47 (3)
- OR4K14 (3)
- OR4L1 (3)
- OR51S1 (3)
- OR52A1 (3)
- OR52A5 (3)
- OR52D1 (3)
- OR52E2 (3)
- OR5B12 (3)
- OR5I1 (3)
- OR5P3 (3)
- OR5V1 (3)
- OR6K2 (3)
- OR6Q1 (3)
- OR8B4 (3)
- OR8D1 (3)
- OR9G1 (3)
- OR9Q1 (3)
- PDE1C (3)
- PRKACG (3)
- PRKX (3)
- ADCY3 (2)
- CLCA4 (2)
- CNGA4 (2)
- OR10A4 (2)
- OR10AD1 (2)
- OR10AG1 (2)
- OR10C1 (2)
- OR10H1 (2)
- OR10H5 (2)
- OR10J1 (2)
- OR10P1 (2)
- OR10R2 (2)
- OR10V1 (2)
- OR10Z1 (2)
- OR12D3 (2)
- OR13C9 (2)
- OR13G1 (2)
- OR13J1 (2)
- OR14J1 (2)
- OR1D5 (2)
- OR1J4 (2)
- OR1N1 (2)
- OR1S1 (2)
- OR2A1 (2)
- OR2A25 (2)
- OR2A4 (2)
- OR2A7 (2)
- OR2AG1 (2)
- OR2AK2 (2)
- OR2B11 (2)
- OR2B2 (2)
- OR2C1 (2)
- OR2G6 (2)
- OR2J3 (2)
- OR2M3 (2)
- OR2M7 (2)
- OR2T1 (2)
- OR2T11 (2)
- OR2T12 (2)
- OR2T2 (2)
- OR2W1 (2)
- OR2Z1 (2)
- OR3A1 (2)
- OR3A2 (2)
- OR4A16 (2)
- OR4C12 (2)