Primary Antibodies

View as table Download

Rabbit polyclonal anti-PDE3B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 948 of mouse PDE3B.

Rabbit Polyclonal Anti-PDE3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN

Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated

PDE3B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-660 of human PDE3B (NP_000913.2).
Modifications Unmodified

PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated

PDE3B mouse monoclonal antibody,clone OTI3F5, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated