Rabbit Polyclonal Anti-MLH1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MLH1 |
Rabbit Polyclonal Anti-MLH1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MLH1 |
Rabbit monoclonal antibody against MLH1(clone EPR3893)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-MLH1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MLH1. |
Rabbit polyclonal Anti-MLH1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MLH1 antibody: synthetic peptide directed towards the N terminal of human MLH1. Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI1B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI4H6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI5F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI6F1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI3C1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI3D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI5A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI2D12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI5H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI10F9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI2A8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody,clone OTI6E8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MLH1 mouse monoclonal antibody, clone OTI4H4
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MLH1 |
MLH1 mouse monoclonal antibody,clone OTI1B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI1B9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MLH1 mouse monoclonal antibody,clone OTI1B9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MLH1 mouse monoclonal antibody,clone OTI1B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MLH1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MLH1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI4H6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI4H6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MLH1 mouse monoclonal antibody,clone OTI4H6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MLH1 mouse monoclonal antibody,clone OTI4H6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI5F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI5F3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MLH1 mouse monoclonal antibody,clone OTI5F3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MLH1 mouse monoclonal antibody,clone OTI5F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI6F1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI6F1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MLH1 mouse monoclonal antibody,clone OTI6F1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MLH1 mouse monoclonal antibody,clone OTI6F1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI3C1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI3C1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MLH1 mouse monoclonal antibody,clone OTI3C1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MLH1 mouse monoclonal antibody,clone OTI3C1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI3D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI3D1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MLH1 mouse monoclonal antibody,clone OTI3D1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MLH1 mouse monoclonal antibody,clone OTI3D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI5A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MLH1 mouse monoclonal antibody,clone OTI5A7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |