Primary Antibodies

View as table Download

Rabbit anti-FKBP4 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FKBP4

Rabbit Polyclonal antibody to FKBP52 (FK506 binding protein 4, 59kDa)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 207 of FKBP52 (Uniprot ID#Q02790)

FKBP52 (FKBP4) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 186-216 amino acids from the Central region of Human FKBP4.

Rabbit Polyclonal anti-FKBP4 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP4 antibody: synthetic peptide directed towards the C terminal of human FKBP4. Synthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA

Goat Anti-FKBP4 / FKBP52 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DHPTDTEMKEEQKSN, from the CTerminus of the protein sequence according to NP_002005.1.

Mouse monoclonal FKBP52 Antibody

Applications IHC
Reactivities Canine, Hamster, Human, Mouse, Rat
Conjugation Unconjugated

FKBP4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4

FKBP4 Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse FKBP4

FKBP4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FKBP4

FKBP4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FKBP4