Primary Antibodies

View as table Download

FUBP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUBP1

Rabbit Polyclonal Anti-FUBP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the middle region of human FUBP1. Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY

FUBP1 mouse monoclonal antibody, clone AT14F5, Purified

Applications ELISA, IF, WB
Reactivities Human

FUBP1 mouse monoclonal antibody, clone AT14F5, Purified

Applications ELISA, IF, WB
Reactivities Human

Goat Anti-Fubp1 (mouse, aa160-174) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DQIVEKGRPAPGFHH, from the internal region of the protein sequence according to NP_476513.2.

Rabbit polyclonal FUBP1 Antibody (Center)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This FUBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-268 amino acids from the Central region of human FUBP1.

Rabbit polyclonal Anti-FUBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the N terminal of human FUBP1. Synthetic peptide located within the following region: IGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM

Rabbit Polyclonal Anti-FUBP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the N terminal of human FUBP1. Synthetic peptide located within the following region: QIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQL

FUBP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUBP1

FUBP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 302-644 of human FUBP1 (NP_003893.2).
Modifications Unmodified

FUBP1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 302-644 of human FUBP1 (NP_003893.2).
Modifications Unmodified

FUBP1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human FUBP1

FUBP1 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated

FUBP1 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated