Primary Antibodies

View as table Download

Rabbit polyclonal COT (Ab-290) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I).

Rabbit polyclonal MAP3K8 (Ab-400) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D).

MAP3K8 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 250-300 of Human Cot.

Rabbit polyclonal MAP3K8 (Ser400) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D).
Modifications Phospho-specific

Rabbit Polyclonal COT Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human COT

Rabbit Polyclonal COT (Thr290) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human COT around the phosphorylation site of Threonine 290
Modifications Phospho-specific

Rabbit Polyclonal anti-MAP3K8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the C terminal of human MAP3K8. Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY

Rabbit Polyclonal anti-MAP3K8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the N terminal of human MAP3K8. Synthetic peptide located within the following region: ASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDL

Rabbit Polyclonal Anti-MAP3K8 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen MAP3K8 / TPL2 antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human MAP3K8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Elephant, Bovine, Dog, Bat (100%); Mouse, Rat, Hamster, Panda, Horse (94%).

Rabbit Polyclonal Anti-MAP3K8 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MAP3K8 / TPL2 antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human MAP3K8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine (100%); Hamster, Panda, Bat, Dog (95%); Mouse, Rat, Rabbit, Pig (89%); Elephant, Horse, Platypus (84%).

Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody,clone OTI2E3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP3K8 (NP_005195.2).

MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody,clone OTI2E3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody,clone OTI2E3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated