Primary Antibodies

Jump to Filters
View as table Download
Perilipin-1 (PLIN1) Guinea Pig Polyclonal Antibody
BP5015

USD 400.00

2 Weeks

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)
CYP8B1 Rabbit Polyclonal Antibody
TA313734

USD 345.00

4 Weeks

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.
CYP27A1 Rabbit Polyclonal Antibody
AP06773PU-N

USD 407.00

2 Weeks

CYP27A1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1.
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
CPT1A Goat Polyclonal Antibody
TA303144

USD 375.00

2 Weeks

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA324720

USD 450.00

2 Weeks

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA319013

USD 355.00

3 Weeks

Rabbit polyclonal anti-Perilipin A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 510 of mouse Perilipin A.
FABP4 (1-30) Rabbit Polyclonal Antibody
AP23179PU-N

USD 440.00

2 Weeks

FABP4 (1-30) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH-conjugated synthetic peptide between amino acids 1-30 from human FABP4
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA332108

USD 375.00

5 Days

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
Apolipoprotein A I (APOA1) (N-term) Rabbit Polyclonal Antibody
AP23390PU-N

USD 405.00

2 Weeks

Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1
CYP7A1 Rabbit Polyclonal Antibody
TA351400

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CYP7A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP7A1