Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Mouse Monoclonal p53 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
p53 mouse monoclonal antibody,clone OTIpab 240
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
p53 mouse monoclonal antibody,clone OTIpab 240
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15
| Applications | 10k-ChIP, FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Families
- Transcription Factors
Pathways
- Thyroid cancer
Citations
- Yes