Primary Antibodies

View as table Download

Rabbit polyclonal antibody to ESE1 (E74-like factor 3 (ets domain transcription factor, epithelial-specific ))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 309 and 371 of ESE1 (Uniprot ID#P78545)

Rabbit Polyclonal Anti-Elf3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of mouse Elf3. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP

Rabbit Polyclonal Anti-Elf3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the N terminal of mouse Elf3. Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL

Goat Polyclonal Antibody against ELF3 / ERT/ ESX

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SGWKEEEVLQSRN, from the C Terminus of the protein sequence according to NP_004424.2.

Rabbit Polyclonal anti-Elf3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of human Elf3. Synthetic peptide located within the following region: GSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDG

Rabbit Polyclonal Anti-ELF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELF3 antibody: synthetic peptide directed towards the middle region of human ELF3. Synthetic peptide located within the following region: PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSD

Rabbit Polyclonal ELF3/ESE-1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen N-terminal sequence and C-terminal sequence of the human ESE-1 protein

Rabbit Polyclonal Anti-Elf3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP

ELF3 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ELF3

ELF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ELF3

ELF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ELF3

ESE1/ELF3 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESE1/ESE1/ELF3 (NP_004424.3).
Modifications Unmodified

ESE1/ELF3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESE1/ESE1/ELF3 (NP_004424.3).
Modifications Unmodified