Primary Antibodies

View as table Download

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Acid Phosphatase (ACP1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 33~61 amino acids from the N-terminal region of human ACP1

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Prostatic Acid Phosphatase (ACPP) (269-282) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001127666.1, NP_001090.2.

Rabbit Polyclonal Anti-ACPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Rabbit Polyclonal Anti-ACP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the middle region of human ACP1. Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA

MTMR6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-143 amino acids from the N-terminal region of Human MTMR6.

Rabbit polyclonal antibody to Myotubularin related protein 2 (myotubularin related protein 2)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 221 and 527 of MTMR2 (Uniprot ID#Q13614)

Rabbit polyclonal antibody to ACPP (acid phosphatase, prostate)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 177 and 362 of Prostatic Acid Phosphatase

Goat Anti-ACPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-YGIHKQKEKSRLQ, from the internal region of the protein sequence according to NP_001090.2.

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL

Goat Anti-ACPP / PAP (aa269-282), Biotinylated Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NHMKRATQIPSYKK., from the internal region of the protein sequence according to NP_001127666.1; NP_001090.2.

Anti-ACPP Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

Anti-ACPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MTMR7

MTMR6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated