Primary Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

ICOS Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ICOS

IL5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5

Rabbit Polyclonal Antibody against CD8A (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

GM CSF (CSF2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 59-85 amino acids from the Central region of Human CSF2

IL10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

Rabbit polyclonal anti-IL-2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein.

IL2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human IL2

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L

Rabbit polyclonal anti-GM-CSF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human GM-CSF protein.

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-Interleukin 2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 2 Antibody: A synthesized peptide derived from human Interleukin 2

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4

USD 320.00

In Stock

Goat Polyclonal Anti-IL10 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human IL10 produced in E. coli.

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

IL10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

Rabbit polyclonal anti-GM-CSF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human GM-CSF

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-10

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5

Rabbit Polyclonal Anti-CD8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B

Rabbit Polyclonal Anti-Interferon gamma Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.

Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ.

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

Rabbit Polyclonal Antibody against CD8A (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A.

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Rabbit Polyclonal TNFA Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TNFA

Anti-Human IL-2 Goat Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-2

Anti-Human IL-2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-2

Anti-Human GM-CSF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GM-CSF

Anti-Human IFN-? Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IFN-γ

Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Rabbit anti-IFNG Polyclonal Antibody

Applications IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNG

Rabbit Polyclonal GM-CSF Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

GM CSF (CSF2) rabbit polyclonal antibody, Serum

Applications IHC, R
Reactivities Bovine
Immunogen Recombinant bovine Granulocyte Macrophage Colony-stimulating Factor

GM CSF (CSF2) rabbit polyclonal antibody, Serum

Applications IHC, R
Reactivities Bovine
Immunogen Recombinant bovine Granulocyte Macrophage Colony-stimulating Factor

IL2 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between aa 57-86 from the Center region of Human IL2

CD40L (CD40LG) (C-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP

Interferon gamma (IFNG) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly purified recombinant Inferferon gamma.

Rabbit polyclonal anti-IL-2 antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen E. coli expressed human IL-2

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-4